PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna28902.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 377aa    MW: 42547.5 Da    PI: 8.0179
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna28902.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.83.9e-161462148
                             TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                             +g+W++eEd +l++++ ++G+g +W + +++ g++R++k+c++rw++yl
  mrna28902.1-v1.0-hybrid 14 KGPWSPEEDSKLKEYIDKYGTGgNWIALPQKAGLKRCGKSCRLRWLNYL 62
                             79*********************************************97 PP

2Myb_DNA-binding40.46.6e-1369111246
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              g +++eEd ++  +++  G++ W+ Ia+ ++ gRt++++k++w++
  mrna28902.1-v1.0-hybrid  69 GEFSEEEDRIICTLFTSIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                              789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.759962IPR017930Myb domain
SuperFamilySSF466892.37E-2711109IPR009057Homeodomain-like
SMARTSM007172.8E-121364IPR001005SANT/Myb domain
PfamPF002492.9E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-241569IPR009057Homeodomain-like
CDDcd001672.68E-91662No hitNo description
PROSITE profilePS5129422.29963117IPR017930Myb domain
SMARTSM007175.8E-1267115IPR001005SANT/Myb domain
PfamPF002496.8E-1169111IPR001005SANT/Myb domain
CDDcd001671.34E-870113No hitNo description
Gene3DG3DSA:1.10.10.603.2E-2370117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDSKLKEYID KYGTGGNWIA LPQKAGLKRC GKSCRLRWLN  60
YLRPNIKHGE FSEEEDRIIC TLFTSIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLRDM  120
QTHMAPPSLT TSQSHRLKPP PFPVSSSLHQ FQSQPFHHQP LSLVHKDLNL MTYSTYAPTL  180
TSPTTGTFSS GFEIMPNIST SLTNYSLFQT QECLVGSMHY NHPAVKKNLN LIMFGSEGSC  240
STSSDGSCNN NPISYESRPS GNLKQEEMGM GFQLEDQNQK FMMLNYGNST TSAAISGDHH  300
NYANNNNNQW GEKPNRYNVN NTRFGDYDLE DVKQLISSSS TDININIDND NQSISNSLFS  360
VDENKTDHKE KVMYFY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-27141177108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117KLKKKLR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744721e-128DQ074472.1 Malus x domestica MYB24 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004293095.10.0PREDICTED: transcription factor RAX2-like
TrEMBLM5VYV61e-147M5VYV6_PRUPE; Uncharacterized protein
STRINGPOPTR_0009s01270.11e-110(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.15e-79myb domain protein 36